PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02018.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 289aa    MW: 31405.4 Da    PI: 7.8168
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02018.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.5e-18194241148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+ Ed ll ++v+q+G g+W+++a+  g++R++k+c++rw +yl
  Zmw_sc02018.1.g00020.1.am.mk 194 KGPWTALEDRLLTEYVQQHGEGCWSSVAKLTGLRRSGKSCRLRWVNYL 241
                                   79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.211189245IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-22191244IPR009057Homeodomain-like
SMARTSM007171.9E-15193243IPR001005SANT/Myb domain
PfamPF002492.0E-16194241IPR001005SANT/Myb domain
SuperFamilySSF466893.12E-21195269IPR009057Homeodomain-like
CDDcd001672.38E-12196241No hitNo description
PROSITE profilePS500904.786242273IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.0E-7245273IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MAHVRRLRQS AIDTGHVDDH VRGALPLQDG VATEGEKETL FRESMTLGAR RLLLSASSAC  60
STRQQSVSDN PISQKGCAWL AWQRPAAAGA GREAEAAMAG YWVAAGCAVA SAVHLELGIA  120
PASPPRTGVR SNSSSLVVER LSKLFPSPLR VCVLSEDVDL HAARPSEADE PEARVIDGFD  180
RERRSLMLQG GWRKGPWTAL EDRLLTEYVQ QHGEGCWSSV AKLTGLRRSG KSCRLRWVNY  240
LRPDLKRGKI TPDEETVIHQ LHAMLGNSLW RLVDGDNCSA GDGSSGGDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-151942672799MYB TRANSFORMING PROTEIN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433